PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015895446.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 502aa    MW: 55267.5 Da    PI: 6.9976
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015895446.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS457.58.3e-1401344931374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     lv++L++cA+av++++l+ a+al++++  la +++ +m+++a yf+eALa+r++r    +y   p ++ + ++ s+ l+    f+e++P+lkf+h
  XP_015895446.1 134 LVHALMACADAVQQNNLNIAEALVKQIGYLAMSQAGAMRKVAMYFAEALARRIYR----IY---PENPLD-HSFSDILQ--MHFYETCPYLKFAH 218
                     689****************************************************....55...333332.23444443..45************ PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     +taNqaIlea++g++rvH+iDf+++qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p++++++ l+e+g++La++Ae+++v fe++ +va++l+dl+
  XP_015895446.1 219 FTANQAILEAFQGKSRVHVIDFSMNQGMQWPALMQALALRPGGPPAFRLTGIGPPAPDNSDHLQEVGWKLAQLAESIHVAFEYRGFVANSLADLD 313
                     *********************************************************************************************** PP

            GRAS 191 leeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                      ++L+++p   E++aVn+v++lh+ll++++++e+    vL++v++++P++v++veqea+hn++ F++rf e+l+yys+lfdsle ++   s++++
  XP_015895446.1 314 ASMLELRPseVESVAVNSVFELHKLLARPGAIEK----VLSVVRQIKPEIVTMVEQEANHNGPVFMDRFNESLHYYSSLFDSLEGSV---SNQDK 401
                     ********88899*********************....************************************************7...999** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     ++++++lg++i n+vaceg er+erhe+l++Wr+rl++aGF++v+l+++a+kqa++ll+ ++ +dgyrvee++g+l+l W++rpL+++SaW+
  XP_015895446.1 402 VMSEVYLGKQILNIVACEGLERVERHEKLNQWRNRLGSAGFSSVSLGSNAYKQASMLLALFAsGDGYRVEENNGCLMLSWHTRPLIATSAWQ 493
                     *******************************************************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.47108472IPR005202Transcription factor GRAS
PfamPF035142.9E-137134493IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 502 aa     Download sequence    Send to blast
MANLRKVPGE VERDERRRQT GRENQSRSTC VFADASSSDY DLKAIPGKAI YGQKTTTATQ  60
LDSSSSSSRE TKRLKTSSGS TSSELFATTT SSSIAAPPPS LPPTYNNNST TVNGDSPSTR  120
PVVLVDSQEN GVRLVHALMA CADAVQQNNL NIAEALVKQI GYLAMSQAGA MRKVAMYFAE  180
ALARRIYRIY PENPLDHSFS DILQMHFYET CPYLKFAHFT ANQAILEAFQ GKSRVHVIDF  240
SMNQGMQWPA LMQALALRPG GPPAFRLTGI GPPAPDNSDH LQEVGWKLAQ LAESIHVAFE  300
YRGFVANSLA DLDASMLELR PSEVESVAVN SVFELHKLLA RPGAIEKVLS VVRQIKPEIV  360
TMVEQEANHN GPVFMDRFNE SLHYYSSLFD SLEGSVSNQD KVMSEVYLGK QILNIVACEG  420
LERVERHEKL NQWRNRLGSA GFSSVSLGSN AYKQASMLLA LFASGDGYRV EENNGCLMLS  480
WHTRPLIATS AWQLAAKPVT TH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-521344934375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015895446.10.0PREDICTED: DELLA protein GAIP-B-like
SwissprotQ8S4W70.0GAI1_VITVI; DELLA protein GAI1
TrEMBLA0A061EFF90.0A0A061EFF9_THECC; GRAS family transcription factor family protein
STRINGPOPTR_0008s13090.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80334121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein